Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G16130_circ_g.2 |
| ID in PlantcircBase | ath_circ_031151 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 9122717-9123159 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT4G16130 |
| Parent gene annotation |
L-arabinokinase |
| Parent gene strand | + |
| Alternative splicing | AT4G16130_circ_g.1 AT4G16130_circ_g.3 AT4G16130_circ_g.4 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G16130.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.275215069 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9122964-9123156(+) |
| Potential amino acid sequence |
MLGKIGYGTVSEALSYKVPFVFVRRDYFNEEPFLRNMLEPSGWNLKETSLPTGWLCLVCGASET LELPPNFIKLAKDAYTPDIIAASDCMLGKIGYGTVSEALSYKVPFVFVRRDYFNEEPFLRNMLE PSGWNLKETSLPTGWLCLVCGASETLELPPNFIKLAKDAYTPDIIAASDCMLGKIGYGTVSEAL SYKVPFVFVRRDYFNEEPFLRNMLEPSGWNLKETSLPTGWLCLVCGASETLELPPNFIKLAKDA YTPDIIAASDCMLGKIGYGTVSEALSYKVPFVFVRRDYFNEEPFLRNMLE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |