Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0468600_circ_g.5 |
| ID in PlantcircBase | osa_circ_011464 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 16709261-16709404 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0468600 |
| Parent gene annotation |
Amidohydrolase 1 domain containing protein. (Os12t0468600-01);No n-protein coding transcript. (Os12t0468600-02);Amidohydrolase 1 domain containing protein. (Os12t0468600-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0468600-01:1 Os12t0468600-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.364912616 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16709346-16709326(+) 16709370-16709263(-) |
| Potential amino acid sequence |
MINSLSLHYQLIFIGYFCNMLRLIQPNRMSSQQIAPQKINFL*(+) MQTKGIDHGTVTYLEKIDFLRSNLLAAHSVWLNKPEHIAEIPYENELVMQTKGIDHGTVTYLEK IDFLRSNLLAAHSVWLNKPEHIAEIPYENELVMQTKGIDHGTVTYLEKIDFLRSNLLAAHSVWL NKPEHIAEIPYENELVMQTKGIDHGTVTYLEKIDFLRSNLLAAHSVWLNKPE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |