Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0284500_circ_g.1 |
ID in PlantcircBase | osa_circ_019224 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 9785278-9785479 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0284500 |
Parent gene annotation |
HAD-superfamily subfamily IIA hydrolase, CECR5 protein. (Os03t02 84500-01);Similar to cat eye syndrome critical region protein 5. (Os03t0284500-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0284500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.308168152 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9785384-9785476(-) |
Potential amino acid sequence |
MHPSSLPTKEVEEHRFSTIYMVGDNPKVDINGALKS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |