Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d022132_circ_g.1 |
ID in PlantcircBase | zma_circ_009469 |
Alias | zma_circ_0002646 |
Organism | Zea mays |
Position | chr7: 170951201-170952088 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d022132 |
Parent gene annotation |
inter-alpha-trypsin inhibitor heavy chain-related |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d022132_T010:4 Zm00001d022132_T001:4 Zm00001d022132_T003:4 Zm00001d022132_T002:4 Zm00001d022132_T005:4 Zm00001d022132_T007:4 Zm00001d022132_T011:4 Zm00001d022132_T012:4 Zm00001d022132_T006:4 Zm00001d022132_T004:4 Zm00001d022132_T009:4 Zm00001d022132_T008:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.182768544 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
170951774-170951204(+) 170951562-170951242(+) |
Potential amino acid sequence |
MKPLLRIGRSKISIFHTMFTRVICLVVCLCNQQHYVTMMIEICSAFFFYLEVATERR*(+) MKKEKIQLTVHSGFSKEILLQGTSHPLKEKSRQGDKLFFHHEAIVENWSIKDFNFSYNVYSGDL SGGVLVQPATLCDYDDRDMFCIFLLPGSGNRKALRLLLEEDHIIPK*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |