Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d012934_circ_g.1 |
| ID in PlantcircBase | zma_circ_008339 |
| Alias | zma_circ_0002015 |
| Organism | Zea mays |
| Position | chr5: 2199144-2199777 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d012934 |
| Parent gene annotation |
Calmodulin binding protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d012934_T001:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.270279443 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2199187-2199157(+) 2199342-2199749(-) |
| Potential amino acid sequence |
MMARSVTDSVPSVSKNLQLQFMTRLSLPIFTGSKIEGEGSLSITIALVDALTRQIVAPGKEFQI KVEIVVLEGDFESGEDDDWTAQEFNNNIVKEREGKRPLISGDAFIALVDGIGTVGELSFTDNSS WTRSRKFRLGARTEDGSFNGVRVREAKTESFVVKDHRGECKRRN*(+) MNCSCKFFDTDGTLSVTLLAIIEAWFAKADSISSFTFSSMVLNHK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |