Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G08820_circ_g.3 |
ID in PlantcircBase | ath_circ_001459 |
Alias | AT1G08820_C1, AT1G08820_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 2822833-2823897 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT1G08820 |
Parent gene annotation |
VAP27-2 |
Parent gene strand | - |
Alternative splicing | AT1G08820_circ_g.1 AT1G08820_circ_g.2 AT1G08820_circ_g.4 AT1G08820_circ_g.5 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G08820.5:4 AT1G08820.4:4 AT1G08820.1:4 AT1G08820.3:4 AT1G08820.2:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.161100171 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2823217-2823891(-) |
Potential amino acid sequence |
MQAFKEPPPDMVCKDKFLIQSTAVSAETTDEDITASMFSKAEGKHIEENKLRVTLVPPSDSPEL SPINTPKQGAVFEDSILKDRLYSQSETLAPPQYLT* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |