Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G08820_circ_g.3 |
| ID in PlantcircBase | ath_circ_001459 |
| Alias | AT1G08820_C1, AT1G08820_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 2822833-2823897 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT1G08820 |
| Parent gene annotation |
VAP27-2 |
| Parent gene strand | - |
| Alternative splicing | AT1G08820_circ_g.1 AT1G08820_circ_g.2 AT1G08820_circ_g.4 AT1G08820_circ_g.5 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G08820.5:4 AT1G08820.4:4 AT1G08820.1:4 AT1G08820.3:4 AT1G08820.2:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.161100171 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2823217-2823891(-) |
| Potential amino acid sequence |
MQAFKEPPPDMVCKDKFLIQSTAVSAETTDEDITASMFSKAEGKHIEENKLRVTLVPPSDSPEL SPINTPKQGAVFEDSILKDRLYSQSETLAPPQYLT* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |