Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G67700_circ_g.1 |
| ID in PlantcircBase | ath_circ_009107 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 25375195-25375453 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G67700 |
| Parent gene annotation |
Protein HHL1, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | 1_circ_ag.4 1_circ_ag.5 1_circ_ag.6 1_circ_ag.7 1_circ_ag.8 AT1G67660_circ_g.1 1_circ_ag.2 AT1G67680_circ_g.1 AT1G67680_circ_g.2 AT1G67690_circ_g.1 AT1G67690_circ_g.2 AT1G67700_circ_g.2 AT1G67700_circ_g.3 AT1G67710_circ_g.1 |
| Support reads | 1 |
| Tissues | seed, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G67700.1:2 AT1G67700.5:2 AT1G67700.2:2 AT1G67700.4:2 AT1G67700.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.207426576 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25375418-25375450(+) |
| Potential amino acid sequence |
MRAALSTSDVIEDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALSTSDVIEDEKEIQK TAIKQHRVLRTATEFRYGYKLVENGNMRAALSTSDVIEDEKEIQKTAIKQHRVLRTATEFRYGY KLVENGNMRAALSTSDVIE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |