Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.010G012300_circ_g.1 |
| ID in PlantcircBase | gra_circ_001070 |
| Alias | Chr10:951355|952299 |
| Organism | Gossypium raimondii |
| Position | chrChr10: 951355-952299 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.010G012300 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 7 |
| Tissues | leaf |
| Exon boundary | Yes-No |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.010G012300.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000860 |
| PMCS | 0.967205265 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
952217-952249(-) 952156-951372(+) |
| Potential amino acid sequence |
MEVCRPLKTDDKLKHRPLNPYRFFRGMICLVVFLSTAFMLLAYLGPGAVLLRYLSIHYSRKATS FFFGLWLSMWPFLFEKVNGTKVVFSGDDVPRKERILIIVNHRTEVDWMYLWDLAMRKGCLGYIK YILKSSLMKLPVLGWGFHVLEFISVDRKWETDETILHQMLSTFKNPRDPLWLALFPEGTDFTEE KCEKSKKFAAEVGLPVLTNVLLPKTRGFCLCLETLRGSFDAGTLSDSRDHYCRQLRRG*(-) MDSKGGALIYHLFSKVCILPYLCFGQLFKEFNPVSAACSNGLESHLMSLHQKSP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |