Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0629100_circ_g.1 |
| ID in PlantcircBase | osa_circ_025468 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 32003899-32004124 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0629100 |
| Parent gene annotation |
Similar to H0303G06.16 protein. (Os04t0629100-01);Similar to H03 03G06.16 protein. (Os04t0629100-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0629100-01:2 Os04t0629100-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.45261427 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32003918-32004099(+) 32003920-32003926(-) |
| Potential amino acid sequence |
MPIKWPYTSSENKGAHSESKIASLRSCNEDCSAQTCQLNGHTRQVRTRVHTQNQK*(+) MFELNNLHCSFSRMLFLILSVHPCSHLTCMAI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |