Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_20G205100_circ_g.1 |
| ID in PlantcircBase | gma_circ_005288 |
| Alias | Gm20circRNA2381 |
| Organism | Glycine max |
| Position | chr20: 44202218-44203151 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat |
| Parent gene | GLYMA_20G205100 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_20G205100_circ_ag.1 GLYMA_20G205100_circ_ag.2 |
| Support reads | NA |
| Tissues | stem |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRG92333:2 KRG92334:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.125516149 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
44202441-44203091(-) |
| Potential amino acid sequence |
MGFEDADEVPELCILAQEYLKKSKGCDESIFEYISSGNVENTDSLYAKLVEELERCILSYLAFH WNQATSVISQTVLLGKFSSSHMFWLPPSPV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |