Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G17560_circ_g.3 |
ID in PlantcircBase | ath_circ_013598 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 7642770-7642998 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G17560 |
Parent gene annotation |
High mobility group B protein 4 |
Parent gene strand | - |
Alternative splicing | AT2G17560_circ_g.1 AT2G17560_circ_g.2 AT2G17560_circ_g.4 AT2G17560_circ_g.5 AT2G17560_circ_g.6 AT2G17560_circ_g.7 AT2G17560_circ_g.8 AT2G17560_circ_g.9 |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G17560.3:2 AT2G17560.1:2 AT2G17560.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.13828155 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7642966-7642772(-) |
Potential amino acid sequence |
MTDEDKAPYVAKAESRKTEYIKNVQQYNLKLVGKAAGARWKAMTDEDKAPYVAKAESRKTEYIK NVQQYNLKLVGKAAGARWKAMTDEDKAPYVAKAESRKTEYIKNVQQYNLKLVGKAAGARWKAMT DEDKAPYVAKAESRKTEYIKNVQQYNLKL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |