Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G044900_circ_g.1 |
| ID in PlantcircBase | gra_circ_000698 |
| Alias | Chr07:3126993|3127345 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 3126993-3127345 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G044900 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.007G044900.1:2 Gorai.007G044900.3:2 Gorai.007G044900.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.337822946 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3127039-3127299(-) 3127044-3127258(-) 3127070-3127299(-) |
| Potential amino acid sequence |
MPTLPEPYSLCITNPGQPRRHLLQSGWSVFVSSKKLVAGDAFIFLRGENGELRVGVRRALRQQG NVPSSVISSHSMHLGVLATAWHAYTTRTIFTVYYKPRSATKTLASKRLECFC*(-) MACLHYQNHIHCVLQTQVSHEDTCFKAVGVFLLAPRSLLLGMHLYF*(-) MHLGVLATAWHAYTTRTIFTVYYKPRSATKTLASKRLECFC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |