Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G45130_circ_g.1 |
ID in PlantcircBase | ath_circ_006062 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 17065702-17065797 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G45130 |
Parent gene annotation |
Beta-galactosidase 5 |
Parent gene strand | + |
Alternative splicing | AT1G45130_circ_g.2 AT1G45130_circ_g.3 AT1G45130_circ_g.4 |
Support reads | 3 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G45130.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.453996265 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17065702-17065794(+) 17065780-17065704(-) |
Potential amino acid sequence |
MWEDLIKKAKDGGLDVIDTYVFWNGHEPSPGTMWEDLIKKAKDGGLDVIDTYVFWNGHEPSPGT MWEDLIKKAKDGGLDVIDTYVFWNGHEPSPGTMWEDLIKKAKDGGLDVIDTYVFWNGHEPSPGT (+) MTIPENISINNIQATVFSFLYKIFPHSSRRRFMTIPENISINNIQATVFSFLYKIFPHSSRRRF MTIPENISINNIQATVFSFLYKIFPHSSRRRFMTIPENISINNIQATVFSFLYKIFPH(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |