Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0596000_circ_g.1 |
ID in PlantcircBase | osa_circ_015291 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 23128452-23129359 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0596000 |
Parent gene annotation |
Rhodanese-like domain containing protein. (Os02t0596000-01);Simi lar to predicted protein. (Os02t0596000-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0596000-02:1 Os02t0596000-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.118758893 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23129051-23129135(-) |
Potential amino acid sequence |
MGGWWSGSSTMTVNKNFVQQVEEKFSKDTDIIVVCQKGLRLGSRRSRLLHPGKLAIHSSSLTRS SLMLGPRMSVKRPG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |