Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G24520_circ_g.6 |
ID in PlantcircBase | ath_circ_032573 |
Alias | AT4G24520_C1 |
Organism | Arabidpsis thaliana |
Position | chr4: 12663940-12664287 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full, CIRI2 |
Parent gene | AT4G24520 |
Parent gene annotation |
NADPH--cytochrome P450 reductase |
Parent gene strand | - |
Alternative splicing | AT4G24520_circ_g.1 AT4G24520_circ_g.2 AT4G24520_circ_g.3 AT4G24520_circ_g.4 AT4G24520_circ_g.5 AT4G24520_circ_g.7 AT4G24520_circ_g.8 |
Support reads | 11 |
Tissues | root, inflorescences, whole_plant, leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G24520.1:2 AT4G24520.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.575721949 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12664237-12663942(-) |
Potential amino acid sequence |
MAAFPSAKPPLGVFFAAIAPRLQPRYYSISSSPRLAPSRVHVTSALVYGPTPTGRIHKGVCSTW MKDEYSQWIVASQRSLLEVMAAFPSAKPPLGVFFAAIAPRLQPRYYSISSSPRLAPSRVHVTSA LVYGPTPTGRIHKGVCSTWMKDEYSQWIVASQRSLLEVMAAFPSAKPPLGVFFAAIAPRLQPRY YSISSSPRLAPSRVHVTSALVYGPTPTGRIHKGVCSTWMKDEYSQWIVASQRSLLEVMAAFPSA KPPLGVFFAAIAPRLQPRYYSISSSPRLAPSRVHVTSALVYGPTPTGRIHKGVCSTWMK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Chu et al., 2017;Zhang et al., 2019 |