Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G24520_circ_g.6 |
| ID in PlantcircBase | ath_circ_032573 |
| Alias | AT4G24520_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 12663940-12664287 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT4G24520 |
| Parent gene annotation |
NADPH--cytochrome P450 reductase |
| Parent gene strand | - |
| Alternative splicing | AT4G24520_circ_g.1 AT4G24520_circ_g.2 AT4G24520_circ_g.3 AT4G24520_circ_g.4 AT4G24520_circ_g.5 AT4G24520_circ_g.7 AT4G24520_circ_g.8 |
| Support reads | 11 |
| Tissues | root, inflorescences, whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G24520.1:2 AT4G24520.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.575721949 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12664237-12663942(-) |
| Potential amino acid sequence |
MAAFPSAKPPLGVFFAAIAPRLQPRYYSISSSPRLAPSRVHVTSALVYGPTPTGRIHKGVCSTW MKDEYSQWIVASQRSLLEVMAAFPSAKPPLGVFFAAIAPRLQPRYYSISSSPRLAPSRVHVTSA LVYGPTPTGRIHKGVCSTWMKDEYSQWIVASQRSLLEVMAAFPSAKPPLGVFFAAIAPRLQPRY YSISSSPRLAPSRVHVTSALVYGPTPTGRIHKGVCSTWMKDEYSQWIVASQRSLLEVMAAFPSA KPPLGVFFAAIAPRLQPRYYSISSSPRLAPSRVHVTSALVYGPTPTGRIHKGVCSTWMK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |