Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G10470_circ_g.3 |
| ID in PlantcircBase | ath_circ_001902 |
| Alias | Ath_circ_FC0289 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 3443252-3443329 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G10470 |
| Parent gene annotation |
Two-component response regulator ARR4 |
| Parent gene strand | - |
| Alternative splicing | AT1G10470_circ_g.1 AT1G10470_circ_g.2 AT1G10470_circ_g.4 AT1G10470_circ_g.5 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G10470.3:1 AT1G10470.2:1 AT1G10470.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.466877677 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3443294-3443254(-) |
| Potential amino acid sequence |
MPGMTGYELLKKIKRLKVDLIITDYCMPGMTGYELLKKIKRLKVDLIITDYCMPGMTGYELLKK IKRLKVDLIITDYCMPGMTGYELLKKIK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |