Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0963300_circ_g.4 |
| ID in PlantcircBase | osa_circ_005947 |
| Alias | Os_ciR6484 |
| Organism | Oryza sativa |
| Position | chr1: 42449465-42449852 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0963300 |
| Parent gene annotation |
Similar to Syntaxin 61 (AtSYP61) (Osmotic stess-sensitive mutant 1). (Os01t0963300-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0963300_circ_g.1 Os01g0963300_circ_g.2 Os01g0963300_circ_g.3 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0963300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.259754618 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
42449827-42449542(+) 42449528-42449782(-) |
| Potential amino acid sequence |
MESSLQLINLITSRTNPVPSSRKLNFVQSIVRWIS*(+) MDWTKLSFLDDGTGLVLLVIRLISCKLLSIDGRKHRQTQENMFI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |