Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0963300_circ_g.4 |
ID in PlantcircBase | osa_circ_005947 |
Alias | Os_ciR6484 |
Organism | Oryza sativa |
Position | chr1: 42449465-42449852 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0963300 |
Parent gene annotation |
Similar to Syntaxin 61 (AtSYP61) (Osmotic stess-sensitive mutant 1). (Os01t0963300-01) |
Parent gene strand | - |
Alternative splicing | Os01g0963300_circ_g.1 Os01g0963300_circ_g.2 Os01g0963300_circ_g.3 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0963300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.259754618 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
42449827-42449542(+) 42449528-42449782(-) |
Potential amino acid sequence |
MESSLQLINLITSRTNPVPSSRKLNFVQSIVRWIS*(+) MDWTKLSFLDDGTGLVLLVIRLISCKLLSIDGRKHRQTQENMFI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |