Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | POPTR_0001s15500_circ_g.1 |
ID in PlantcircBase | pop_circ_000171 |
Alias | Chr01:12831515-12832814 |
Organism | Populus trichocarpa |
Position | chr1: 12332527-12333826 JBrowse» |
Reference genome | Populus trichocarpa genome v3.0 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | POPTR_0001s15500 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | POPTR_0001s15500_circ_g.2 |
Support reads | NA |
Tissues | stem xylem |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | POPTR_0001s15500.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | csi_circ_002966 ptr_circ_000139* |
PMCS | 0.113350308 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12333775-12332548(+) 12332545-12333437(+) |
Potential amino acid sequence |
MYSFYMGVQIWCLQSKRLCYRYLYG*(+) MDESAVSSDPVIAFLLDEVVVKDWCKRTFKKITAELQLLQESISKAKQHMEIIAWCARHHFLEN VRSRYTNLSSWRSVVHQRKSAAIKRSWPDVANQSAESSMLAGSLFIEDALANLKIEQNHMQEMG EESELAPLQKDGGLFCKSKLEGLEVCYPFKNLRAAVDVLFLHGSSDLVLAKQAIMLQIFVWMKV LCLAILSLLSCWMKWLSRIGASGHLKKSQRNFNSFKRAFQRRNSIWRL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Liu et al., 2021 |