Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0001s15500_circ_g.1 |
| ID in PlantcircBase | pop_circ_000171 |
| Alias | Chr01:12831515-12832814 |
| Organism | Populus trichocarpa |
| Position | chr1: 12332527-12333826 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | POPTR_0001s15500 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | POPTR_0001s15500_circ_g.2 |
| Support reads | NA |
| Tissues | stem xylem |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | POPTR_0001s15500.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | csi_circ_002966 ptr_circ_000139* |
| PMCS | 0.113350308 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12333775-12332548(+) 12332545-12333437(+) |
| Potential amino acid sequence |
MYSFYMGVQIWCLQSKRLCYRYLYG*(+) MDESAVSSDPVIAFLLDEVVVKDWCKRTFKKITAELQLLQESISKAKQHMEIIAWCARHHFLEN VRSRYTNLSSWRSVVHQRKSAAIKRSWPDVANQSAESSMLAGSLFIEDALANLKIEQNHMQEMG EESELAPLQKDGGLFCKSKLEGLEVCYPFKNLRAAVDVLFLHGSSDLVLAKQAIMLQIFVWMKV LCLAILSLLSCWMKWLSRIGASGHLKKSQRNFNSFKRAFQRRNSIWRL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Liu et al., 2021 |