Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G24510_circ_g.6 |
ID in PlantcircBase | ath_circ_004192 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 8686509-8686775 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G24510 |
Parent gene annotation |
T-complex protein 1 subunit epsilon |
Parent gene strand | - |
Alternative splicing | AT1G24510_circ_g.2 AT1G24510_circ_g.3 AT1G24510_circ_g.4 AT1G24510_circ_g.5 AT1G24510_circ_g.7 |
Support reads | 5 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G24510.2:2 AT1G24510.3:2 AT1G24510.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.256779183 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8686713-8686511(-) |
Potential amino acid sequence |
MHRNLPAVRWVGGVELELIAIATGGRIVPRFQELTPEKLGKDVGATLVICQWGFDDEANHLLMH RNLPAVRWVGGVELELIAIATGGRIVPRFQELTPEKLGKDVGATLVICQWGFDDEANHLLMHRN LPAVRWVGGVELELIAIATGGRIVPRFQELTPEKLGKDVGATLVICQWGFDDEANHLLMHRNLP AVRWVGGVELELIAIATGGRIVPRFQELTPEKLGK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |