Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0836200_circ_g.1 |
ID in PlantcircBase | osa_circ_022611 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 35135312-35135855 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0836200 |
Parent gene annotation |
Similar to RNA-binding protein RZ-1. (Os03t0836200-01);Similar t o RNA-binding protein RZ-1. (Os03t0836200-02);Similar to RNA-bin ding protein RZ-1. (Os03t0836200-03) |
Parent gene strand | - |
Alternative splicing | Os03g0836200_circ_g.2 Os03g0836200_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0836200-01:1 Os03t0836200-03:1 Os03t0836200-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005244* |
PMCS | 0.314886596 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35135786-35135330(+) 35135351-35135809(-) |
Potential amino acid sequence |
MAFFSSKVTKPKPRERPEYLSKTTWMEHTS*(+) MAYQISKKYVPSRWFLTSILAVLVVLAL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |