Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0836200_circ_g.1 |
| ID in PlantcircBase | osa_circ_022611 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 35135312-35135855 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0836200 |
| Parent gene annotation |
Similar to RNA-binding protein RZ-1. (Os03t0836200-01);Similar t o RNA-binding protein RZ-1. (Os03t0836200-02);Similar to RNA-bin ding protein RZ-1. (Os03t0836200-03) |
| Parent gene strand | - |
| Alternative splicing | Os03g0836200_circ_g.2 Os03g0836200_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0836200-01:1 Os03t0836200-03:1 Os03t0836200-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005244* |
| PMCS | 0.314886596 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35135786-35135330(+) 35135351-35135809(-) |
| Potential amino acid sequence |
MAFFSSKVTKPKPRERPEYLSKTTWMEHTS*(+) MAYQISKKYVPSRWFLTSILAVLVVLAL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |