Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G40430_circ_g.11 |
ID in PlantcircBase | ath_circ_017632 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 16881661-16881965 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT2G40430 |
Parent gene annotation |
P60-like (InterPro:IPR011687), Tumour suppressor protein Gltscr2 (InterPro:IPR011211) |
Parent gene strand | - |
Alternative splicing | AT2G40430_circ_g.1 AT2G40430_circ_g.2 AT2G40430_circ_g.3 AT2G40430_circ_g.4 AT2G40430_circ_g.5 AT2G40430_circ_g.6 AT2G40430_circ_g.7 AT2G40430_circ_g.8 AT2G40430_circ_g.9 AT2G40430_circ_g.10 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G40430.1:2 AT2G40430.3:1 AT2G40430.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.121328989 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16881692-16881663(-) |
Potential amino acid sequence |
MADLWGDDSKDLPVKRKIEKHRERVLRVDSILKKNPFVQLVPSSKPKLKKSKKTIVIEDKAPKQ VQKSVGDDSVMADLWGDDSKDLPVKRKIEKHRERVLRVDSILKKNPFVQLVPSSKPKLKKSKKT IVIEDKAPKQVQKSVGDDSVMADLWGDDSKDLPVKRKIEKHRERVLRVDSILKKNPFVQLVPSS KPKLKKSKKTIVIEDKAPKQVQKSVGDDSVMADLWGDDSK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |