Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G40430_circ_g.11 |
| ID in PlantcircBase | ath_circ_017632 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 16881661-16881965 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT2G40430 |
| Parent gene annotation |
P60-like (InterPro:IPR011687), Tumour suppressor protein Gltscr2 (InterPro:IPR011211) |
| Parent gene strand | - |
| Alternative splicing | AT2G40430_circ_g.1 AT2G40430_circ_g.2 AT2G40430_circ_g.3 AT2G40430_circ_g.4 AT2G40430_circ_g.5 AT2G40430_circ_g.6 AT2G40430_circ_g.7 AT2G40430_circ_g.8 AT2G40430_circ_g.9 AT2G40430_circ_g.10 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G40430.1:2 AT2G40430.3:1 AT2G40430.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.121328989 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16881692-16881663(-) |
| Potential amino acid sequence |
MADLWGDDSKDLPVKRKIEKHRERVLRVDSILKKNPFVQLVPSSKPKLKKSKKTIVIEDKAPKQ VQKSVGDDSVMADLWGDDSKDLPVKRKIEKHRERVLRVDSILKKNPFVQLVPSSKPKLKKSKKT IVIEDKAPKQVQKSVGDDSVMADLWGDDSKDLPVKRKIEKHRERVLRVDSILKKNPFVQLVPSS KPKLKKSKKTIVIEDKAPKQVQKSVGDDSVMADLWGDDSK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |