Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0280400_circ_g.1 |
ID in PlantcircBase | osa_circ_014269 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 10373432-10375760 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0280400 |
Parent gene annotation |
Similar to casein kinase I isoform delta-like. (Os02t0280400-01) ;Similar to Dual specificity kinase 1. (Os02t0280400-02);Hypothe tical gene. (Os02t0280400-03) |
Parent gene strand | + |
Alternative splicing | Os02g0280400_circ_g.2 Os02g0280400_circ_g.3 Os02g0280400_circ_g.4 Os02g0280400_circ_g.5 Os02g0280400_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0280400-01:7 Os02t0280400-02:9 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.12716516 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10375166-10374763(+) 10373464-10375465(-) |
Potential amino acid sequence |
MEFLVQVLCKSHPVEFASYFHYCHSLTFDQRPDYGFLRRLFRDLADREGYQYDHVFDWTLLKCK QSQKAKAQQQDPGVSSRAVPTNIEKHQAGIANIKWCGIDGEDNVLVIDLLGPSLEDLFVYCGRR FSLKTVLMLADQMITRVEFMHSKGYLHRDIKPDNFLMGLGRKANQVYIIDFGLAKRYRDATTNR HIPYRENKNLTGTARYASCNTHLGIEQSRRDDLESIGYVLLYFLRGR*(+) MPHHFMFAIPAWCFSIFVGTARLLTPGSCC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |