Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0280400_circ_g.1 |
| ID in PlantcircBase | osa_circ_014269 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 10373432-10375760 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0280400 |
| Parent gene annotation |
Similar to casein kinase I isoform delta-like. (Os02t0280400-01) ;Similar to Dual specificity kinase 1. (Os02t0280400-02);Hypothe tical gene. (Os02t0280400-03) |
| Parent gene strand | + |
| Alternative splicing | Os02g0280400_circ_g.2 Os02g0280400_circ_g.3 Os02g0280400_circ_g.4 Os02g0280400_circ_g.5 Os02g0280400_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0280400-01:7 Os02t0280400-02:9 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.12716516 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10375166-10374763(+) 10373464-10375465(-) |
| Potential amino acid sequence |
MEFLVQVLCKSHPVEFASYFHYCHSLTFDQRPDYGFLRRLFRDLADREGYQYDHVFDWTLLKCK QSQKAKAQQQDPGVSSRAVPTNIEKHQAGIANIKWCGIDGEDNVLVIDLLGPSLEDLFVYCGRR FSLKTVLMLADQMITRVEFMHSKGYLHRDIKPDNFLMGLGRKANQVYIIDFGLAKRYRDATTNR HIPYRENKNLTGTARYASCNTHLGIEQSRRDDLESIGYVLLYFLRGR*(+) MPHHFMFAIPAWCFSIFVGTARLLTPGSCC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |