Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0661400_circ_g.1 |
| ID in PlantcircBase | osa_circ_003101 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 27005609-27007022 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0661400 |
| Parent gene annotation |
S1, RNA binding domain containing protein. (Os01t0661400-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0661400-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.116464516 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27007021-27007017(+) 27006339-27006949(-) |
| Potential amino acid sequence |
MNFLVDIKGPNLAFLPVLAFEGGTRRNIPKFEIGTLIYARVVKANSIMNPELSCMDATGKAAEF GQLKDGYMFDTSTGLSRMLLSSPTCPILEALGKKLSFEIAVGLNGRVWVNAPSPSNVIVVSNAI IKSESLSGIGQRSMVESLLERLS*(+) MHESSGFMMLFAFTTRAYINVPISNFGIFLLVPPSNARTGKKAKLGPFISTKKFIKIVSPRDFP PYFVALCHSKILIL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |