Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d022388_circ_g.6 |
ID in PlantcircBase | zma_circ_009500 |
Alias | zma_circ_0002675, GRMZM2G036609_C1 |
Organism | Zea mays |
Position | chr7: 176594111-176594716 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d022388 |
Parent gene annotation |
Ferredoxin-dependent glutamate synthase, chloroplastic |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d022388_T012:3 Zm00001d022388_T006:3 Zm00001d022388_T003:3 Zm00001d022388_T015:3 Zm00001d022388_T002:3 Zm00001d022388_T011:3 Zm00001d022388_T005:3 Zm00001d022388_T014:3 Zm00001d022388_T016:3 Zm00001d022388_T008:3 Zm00001d022388_T004:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.417197339 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
176594623-176594144(+) 176594186-176594715(-) 176594692-176594500(-) |
Potential amino acid sequence |
MLLVDSVRIITFLTNCFVQQLGHLRIICMVFTCLMALVAVSPF*(+) MVILQHFLISRVFRMVTQPQVPLSR*(-) MSKLLHKAIREKRDNAYTVYQQHLASRPVNVLRDLLELKSDRAPIPIGKVESATSIVERFCTGG MSLGAISRETHEAIAIAMNRIGGKSNSGEGGEDPIRWNPLTDVVDGYSPTLPHLKGLQNGDTAT SAIKQVNTMQIILRCPSCCTKQFVRNVIMRTLSTNNILQAVLSMFFEIFLN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |