Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0691500_circ_g.2 |
| ID in PlantcircBase | osa_circ_003426 |
| Alias | Os01circ20820 |
| Organism | Oryza sativa |
| Position | chr1: 28542868-28542973 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os01g0691500 |
| Parent gene annotation |
Cytidylyltransferase domain containing protein. (Os01t0691500-01 );Similar to Cytidyltransferase-related. (Os01t0691500-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0691500_circ_g.1 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0691500-02:1 Os01t0691500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.233558333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28542952-28542909(+) 28542974-28542967(-) 28542967-28542967(-) |
| Potential amino acid sequence |
MEDHHHTCFLNCSTRRLISAIDSGGLSALIADISKHGRPSSHMFSKLLNPALDFCDR*(+) MCDDGLPCFEISAINADKPPLSIAEIKRRVEQFRKHV*(-) MMVFHALRYQQSMPTNLHYLSQKSSAGLSNLENMCDDGLPCFEISAINADKPPLSIAEIKRRVE QFRKHV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |