Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0455900_circ_g.3 |
ID in PlantcircBase | osa_circ_006964 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 16657232-16658465 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0455900 |
Parent gene annotation |
Pleckstrin homology-type domain containing protein. (Os10t045590 0-01) |
Parent gene strand | + |
Alternative splicing | Os10g0455900_circ_g.2 Os10g0455900_circ_g.4 Os10g0455900_circ_g.5 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os10t0455900-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.155409569 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16657292-16657267(+) |
Potential amino acid sequence |
MANMAPPVSSKKGRTTQDNTMQTGLQMDQSRQSTMLDEESDEDEDQIPESEQETSTHGHDAPVK LPVLDEEDSDQIDVSGFSGNLRRDDRDNTRDCWRMSDGNNFRVRSKTFIYDKSKIPAGKPLMKL VAVDWFKDVKRMDHVARRKGCAVQVAAEKGLFALAVNLQGSGNGFHKVMKI*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |