Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0174100_circ_g.1 |
ID in PlantcircBase | osa_circ_010659 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 3756365-3756569 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0174100 |
Parent gene annotation |
Protein of unknown function DUF246, plant family protein. (Os12t 0174100-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0174100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.206260163 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3756496-3756391(+) 3756416-3756448(-) |
Potential amino acid sequence |
MVERMVKRSTLTGGKFVSVHLRFEEGCANCPILK*(+) MELIVPVYLRMGQFAQPSSKRRCTDTNFPPVKVLRFTILSTISSARTLIGSANLNAW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |