Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0278900_circ_g.3 |
ID in PlantcircBase | osa_circ_023281 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 11803377-11811761 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0278900 |
Parent gene annotation |
Similar to OSIGBa0113C11.1 protein. (Os04t0278900-01);tRNA-dihyd rouridine synthase domain containing protein. (Os04t0278900-02) |
Parent gene strand | - |
Alternative splicing | Os04g0278900_circ_g.1 Os04g0278900_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0278900-01:1 Os04t0278900-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.182321633 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11811714-11803761(+) |
Potential amino acid sequence |
MKCLVGDFETTLSTNSLIICSPANHNSMCTLSYGCSDLINSSYTSI*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |