Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0178000_circ_g.2 |
| ID in PlantcircBase | osa_circ_000514 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 4056396-4057292 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0178000 |
| Parent gene annotation |
Pyridoxal phosphate-dependent transferase, major region, subdoma in 1 domain containing protein. (Os01t0178000-01);Similar to Tra nsaminase/ transferase, transferring nitrogenous groups. (Os01t0 178000-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0178000_circ_g.1 Os01g0178000_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0178000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.255558561 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4057193-4056513(+) 4057249-4057274(-) 4056447-4057043(-) |
| Potential amino acid sequence |
MTGASVSTALLASLPKLPISPPPPPLPHPSKNKNFSRSASRSSGRPSSEPYLLIDGSHTISLIL FIAASGGCQ*(+) MGSFGRLARRAVETEAPVMVKMQELLRGNKDVMSLAQGVVYWQPPEAAMNKIKEIVWEPSISKY GSDDGLPELREALLEKFLFLEG*(-) MALMMVFLNSEKHFSRSSCSWRGEEEEEEEVRWVASGGWRGGPWRRKRRSWSRCRNCFEGTRM* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |