Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d008619_circ_g.2 |
ID in PlantcircBase | zma_circ_009552 |
Alias | Zm08circ00007, GRMZM2G018177_C2 |
Organism | Zea mays |
Position | chr8: 14788396-14789122 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d008619 |
Parent gene annotation |
triose phosphate isomerase3 |
Parent gene strand | - |
Alternative splicing | Zm00001d008619_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d008619_T002:3 Zm00001d008619_T003:3 Zm00001d008619_T001:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.135757542 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14788475-14788398(-) |
Potential amino acid sequence |
MLVNLGVPWVILGHSERRALLGESNENGTTDQVEKIVKTLNEGNVPSSDVVEVVVSPPYVFLPV VKSQLRQEFQVAAQNCWVKKGGAFTGEISAEMLVNLGVPWVILGHSERRALLGESNENGTTDQV EKIVKTLNEGNVPSSDVVEVVVSPPYVFLPVVKSQLRQEFQVAAQNCWVKKGGAFTGEISAEML VNLGVPWVILGHSERRALLGESNENGTTDQVEKIVKTLNEGNVPSSDVVEVVVSPPYVFLPVVK SQLRQEFQVAAQNCWVKKGGAFTGEISAEMLVNLGVPWVILGHSERRALLGESNE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |