Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0403100_circ_g.2 |
| ID in PlantcircBase | osa_circ_020260 |
| Alias | Os_ciR4719 |
| Organism | Oryza sativa |
| Position | chr3: 16428156-16428647 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0403100 |
| Parent gene annotation |
Similar to DNA-directed RNA polymerase subunit. (Os03t0403100-01 ) |
| Parent gene strand | + |
| Alternative splicing | Os03g0403100_circ_g.1 Os03g0403100_circ_g.3 |
| Support reads | 4/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0403100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.13551438 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16428202-16428644(+) 16428216-16428625(-) |
| Potential amino acid sequence |
MLRRMMDAILNADTFDDKDYVGNKRLELSGQLISLLFEVESGNFRPKCIYTAVMLRRMMDAILN ADTFDDKDYVGNKRLELSGQLISLLFEVESGNFRPKCIYTAVMLRRMMDAILNADTFDDKDYVG NKRLELSGQLISLLFEVESGNFRPKCIYTAVMLRRMMDAILNADTFDDKDYVGNKRLELSGQLI SLLFE(+) MRLNITAVYMHFGRKFPLSTSKSRDIS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |