Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0121300_circ_g.1 |
ID in PlantcircBase | osa_circ_017649 |
Alias | Os_ciR8468 |
Organism | Oryza sativa |
Position | chr3: 1179567-1179755 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os03g0121300 |
Parent gene annotation |
Similar to Peroxidase 1. (Os03t0121300-01);Similar to Peroxidase 5. (Os03t0121300-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0121300-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.236775 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1179602-1179752(+) |
Potential amino acid sequence |
MSAQETTPLHALSSRRLALSTTSNPLRLLFGIASFSAVLFAVESSKTDASHPSTTLSLAAKASM SAQETTPLHALSSRRLALSTTSNPLRLLFGIASFSAVLFAVESSKTDASHPSTTLSLAAKASMS AQETTPLHALSSRRLALSTTSNPLRLLFGIASFSAVLFAVESSKTDASHPSTTLSLAAKASMSA QETTPLHALSSRRLALSTTSNPLRLLFGIASFSAVLFAVESSKTDASH(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |