Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G51710_circ_g.6 |
ID in PlantcircBase | ath_circ_006821 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 19176543-19176792 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G51710 |
Parent gene annotation |
Ubiquitin carboxyl-terminal hydrolase 6 |
Parent gene strand | - |
Alternative splicing | AT1G51710_circ_g.3 AT1G51710_circ_g.4 AT1G51710_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G51710.1:2 AT1G51710.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.160412733 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19176558-19176545(-) |
Potential amino acid sequence |
MTDAEKVDYPLVLDIFDLCSEDLRKKLEAPRQKLREEEGKKLGLQTSAKSGSKDSDVKMTDAEK VDYPLVLDIFDLCSEDLRKKLEAPRQKLREEEGKKLGLQTSAKSGSKDSDVKMTDAEKVDYPLV LDIFDLCSEDLRKKLEAPRQKLREEEGKKLGLQTSAKSGSKDSDVKMTDAE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |