Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0169800_circ_g.2 |
| ID in PlantcircBase | osa_circ_010629 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 3555467-3556074 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0169800 |
| Parent gene annotation |
Similar to Calcium-dependent protein kinase SK5 (EC 2.7.1.-) (CD PK). (Os12t0169800-00) |
| Parent gene strand | - |
| Alternative splicing | Os12g0169800_circ_g.1 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0169800-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_001403 |
| PMCS | 0.376111952 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3555941-3555517(+) 3555738-3555975(-) |
| Potential amino acid sequence |
MGAHHTAKCTGLPQHSRRQLLGHRFFEAPQVRHNKGSQQHQKICHPQSHLLELVHCRKVFQP*( +) MLIRDPTKRFTAHEVLCHPWIVDDAVAPDKPIDSAVLSRLKHFSAMNKLKKMALRVTNFLMLLG ALIMSHLRCFKKSMAQKLTSGVLG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |