Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G01800_circ_g.12 |
| ID in PlantcircBase | ath_circ_029256 |
| Alias | At_ciR4828, AT4G01800_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 773591-774130 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT4G01800 |
| Parent gene annotation |
Albino or Glassy Yellow 1 |
| Parent gene strand | - |
| Alternative splicing | AT4G01800_circ_g.1 AT4G01800_circ_g.2 AT4G01800_circ_g.3 AT4G01800_circ_g.4 AT4G01800_circ_g.5 AT4G01800_circ_g.6 AT4G01800_circ_g.7 AT4G01800_circ_g.8 AT4G01800_circ_g.9 AT4G01800_circ_g.10 AT4G01800_circ_g.11 |
| Support reads | 2/8 |
| Tissues | leaf/seedlings |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G01800.1:2 AT4G01800.2:2 AT4G01800.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.342122353 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
774113-773593(-) |
| Potential amino acid sequence |
MTGTASTESAEFESIYKLKVTIVPTNKPMIRKDESDVVFKAVNGKWRAVVVEISRMHKTGRAVL VGTTSVEQSDELSQLLREAGITHEFPKLCGMTGTASTESAEFESIYKLKVTIVPTNKPMIRKDE SDVVFKAVNGKWRAVVVEISRMHKTGRAVLVGTTSVEQSDELSQLLREAGITHEFPKLCGMTGT ASTESAEFESIYKLKVTIVPTNKPMIRKDESDVVFKAVNGKWRAVVVEISRMHKTGRAVLVGTT SVEQSDELSQLLREAGITHEFPKLCGMTGTASTESAEFESIYKLKVTIVPTNKPMIRKDESDVV FKAVNGKWRAVVVEISRMHKTGRAVLVGTTSVEQSDELSQLLREAGITHE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress; responsive to heat stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Pan et al., 2017;Zhang et al., 2019 |