Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0703400_circ_g.2 |
| ID in PlantcircBase | osa_circ_010088 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 28786965-28787800 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0703400 |
| Parent gene annotation |
Similar to BRI1-KD interacting protein 109. (Os11t0703400-01);Si milar to BRI1-KD interacting protein 109. (Os11t0703400-02) |
| Parent gene strand | - |
| Alternative splicing | Os11g0703400_circ_g.1 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0703400-01:2 Os11t0703400-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.144537679 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28787026-28786965(+) 28787762-28786999(+) 28787010-28787769(-) 28787779-28787062(-) |
| Potential amino acid sequence |
MSCADKVLCHNFYGSHLSLLGHLLDLGDELLLLSLQALPLPLDLPDGFIQHPLVLPQQL*(+) MDLSSIRLFSRSNSEFEEIHPVAGT*(+) MPSSPSYRVYLFEFRVAAGEQADAG*(-) MLDKSIREIERERQGLQAQEKKLIAEIKKVAKQGQMGAVKIMAKDLIRTRHQITKFYALKSQLQ GVSLRIQSCCGRTSGCWINPSGRSRGRGRACRLRRRSSSPRSRRWPSKDRWEP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |