Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0703400_circ_g.2 |
ID in PlantcircBase | osa_circ_010088 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 28786965-28787800 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0703400 |
Parent gene annotation |
Similar to BRI1-KD interacting protein 109. (Os11t0703400-01);Si milar to BRI1-KD interacting protein 109. (Os11t0703400-02) |
Parent gene strand | - |
Alternative splicing | Os11g0703400_circ_g.1 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0703400-01:2 Os11t0703400-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.144537679 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28787026-28786965(+) 28787762-28786999(+) 28787010-28787769(-) 28787779-28787062(-) |
Potential amino acid sequence |
MSCADKVLCHNFYGSHLSLLGHLLDLGDELLLLSLQALPLPLDLPDGFIQHPLVLPQQL*(+) MDLSSIRLFSRSNSEFEEIHPVAGT*(+) MPSSPSYRVYLFEFRVAAGEQADAG*(-) MLDKSIREIERERQGLQAQEKKLIAEIKKVAKQGQMGAVKIMAKDLIRTRHQITKFYALKSQLQ GVSLRIQSCCGRTSGCWINPSGRSRGRGRACRLRRRSSSPRSRRWPSKDRWEP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |