Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0120100_circ_g.2 |
| ID in PlantcircBase | osa_circ_012806 |
| Alias | Os_ciR7622 |
| Organism | Oryza sativa |
| Position | chr2: 1051378-1051512 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0120100 |
| Parent gene annotation |
ATMRK serine/threonine protein kinase-like domain containing pro tein. (Os02t0120100-01);Similar to ATP binding protein. (Os02t01 20100-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0120100_circ_g.3 Os02g0120100_circ_g.4 Os02g0120100_circ_g.5 Os02g0120100_circ_g.6 Os02g0120100_circ_g.7 Os02g0120100_circ_g.8 Os02g0120100_circ_g.9 Os02g0120100_circ_g.10 Os02g0120100_circ_g.11 Os02g0120100_circ_g.12 Os02g0120100_circ_g.13 Os02g0120100_circ_g.14 Os02g0120100_circ_g.15 Os02g0120100_circ_g.16 Os02g0120100_circ_g.17 Os02g0120100_circ_g.18 Os02g0120100_circ_g.19 Os02g0120100_circ_g.20 Os02g0120100_circ_g.21 Os02g0120100_circ_g.22 Os02g0120100_circ_g.23 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0120100-02:1 Os02t0120100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.146911111 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1051445-1051509(+) |
| Potential amino acid sequence |
MPAFLKQLRQLGVRIFRNCWSKALFGESLKNLQYLGEVRPFSRISMPAFLKQLRQLGVRIFRNC WSKALFGESLKNLQYLGEVRPFSRISMPAFLKQLRQLGVRIFRNCWSKALFGESLKNLQYLGEV RPFSRISMPAFLKQLRQLGVRIFRNCWSKA(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |