Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d037982_circ_g.9 |
ID in PlantcircBase | zma_circ_009094 |
Alias | zma_circ_0002362, GRMZM2G416667_C3 |
Organism | Zea mays |
Position | chr6: 144246659-144252174 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d037982 |
Parent gene annotation |
AMP deaminase |
Parent gene strand | - |
Alternative splicing | Zm00001d037982_circ_g.6 Zm00001d037982_circ_g.7 Zm00001d037982_circ_g.8 Zm00001d037982_circ_g.10 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d037982_T006:8 Zm00001d037982_T008:5 Zm00001d037982_T005:7 Zm00001d037982_T004:5 Zm00001d037982_T002:7 Zm00001d037982_T003:7 Zm00001d037982_T001:7 Zm00001d037982_T007:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.152514347 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
144252027-144252170(-) |
Potential amino acid sequence |
MDTSGNLEGEHKGNAIVENGAAKPLAAANLIRSRSKSNNLHAVQPDPVAADILRKEPQQESFVK LLTTPKEIPTADEIEVFKILQKCLELRDSYLFREEVAPWEKEVINDPCTPKPNPNPFTYVPEPK SEHVFQTVDGVIHVYADKDCTESIYPVADATTFFTDLHYILRVTAAGNTRTVCHNRLNLLEHKF KFHLMLNADREFLAQKTAPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKSKLRKEPDEVVIFRD GTYMTLKEVFESLDLTGQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |