Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d037982_circ_g.9 |
| ID in PlantcircBase | zma_circ_009094 |
| Alias | zma_circ_0002362, GRMZM2G416667_C3 |
| Organism | Zea mays |
| Position | chr6: 144246659-144252174 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d037982 |
| Parent gene annotation |
AMP deaminase |
| Parent gene strand | - |
| Alternative splicing | Zm00001d037982_circ_g.6 Zm00001d037982_circ_g.7 Zm00001d037982_circ_g.8 Zm00001d037982_circ_g.10 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d037982_T006:8 Zm00001d037982_T008:5 Zm00001d037982_T005:7 Zm00001d037982_T004:5 Zm00001d037982_T002:7 Zm00001d037982_T003:7 Zm00001d037982_T001:7 Zm00001d037982_T007:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.152514347 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
144252027-144252170(-) |
| Potential amino acid sequence |
MDTSGNLEGEHKGNAIVENGAAKPLAAANLIRSRSKSNNLHAVQPDPVAADILRKEPQQESFVK LLTTPKEIPTADEIEVFKILQKCLELRDSYLFREEVAPWEKEVINDPCTPKPNPNPFTYVPEPK SEHVFQTVDGVIHVYADKDCTESIYPVADATTFFTDLHYILRVTAAGNTRTVCHNRLNLLEHKF KFHLMLNADREFLAQKTAPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKSKLRKEPDEVVIFRD GTYMTLKEVFESLDLTGQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |