Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d036345_circ_g.2 |
ID in PlantcircBase | zma_circ_008959 |
Alias | zma_circ_0002512 |
Organism | Zea mays |
Position | chr6: 85063636-85063871 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d036345 |
Parent gene annotation |
yellow endosperm1 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d036345_T001:1 Zm00001d036345_T002:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.461661194 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
85063649-85063648(+) 85063641-85063746(-) |
Potential amino acid sequence |
MIEGMRSDLRKTRYNNFDELYMYCYYVAGTVGLMSVPVMGIATESKATTESVYSAALALGIANQ LTNILRDVGEDHSGT*(+) MVLSNIPEYVRELVRNSQSQGSTVYAFSCCFRLGCDAHHRYAH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |