Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0498800_circ_g.8 |
| ID in PlantcircBase | osa_circ_033942 |
| Alias | Os_ciR4065 |
| Organism | Oryza sativa |
| Position | chr7: 18723701-18724478 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, circseq_cup, find_circ |
| Parent gene | Os07g0498800 |
| Parent gene annotation |
Similar to Calreticulin interacted protein. (Os07t0498800-01);Si milar to Calreticulin interacted protein. (Os07t0498800-02) |
| Parent gene strand | - |
| Alternative splicing | Os07g0498800_circ_g.1 Os07g0498800_circ_g.2 Os07g0498800_circ_g.3 Os07g0498800_circ_g.4 Os07g0498800_circ_g.5 Os07g0498800_circ_g.6 Os07g0498800_circ_g.7 Os07g0498800_circ_g.9 |
| Support reads | 2/2/2 |
| Tissues | root/root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0498800-02:2 Os07t0498800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.216019002 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18723792-18724461(-) |
| Potential amino acid sequence |
MGTHCIWLLGVQLLKANILLVLLMKTPMLMVPVLVLKEKIVEATGVPVDQQRLIFRGRVLKDDH LLSEYHLEDGYTLHLVARRAAAEGQHSSGTSDENTHANGTCSGP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |