Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0869000_circ_g.2 |
| ID in PlantcircBase | osa_circ_004987 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 37658734-37658896 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, circseq_cup |
| Parent gene | Os01g0869000 |
| Parent gene annotation |
Protein of unknown function DUF639 family protein. (Os01t0869000 -01);Hypothetical conserved gene. (Os01t0869000-02);Protein of u nknown function DUF639 domain containing protein. (Os01t0869000- 03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/3 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0869000-03:1 Os01t0869000-01:1 Os01t0869000-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.47337454 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
37658858-37658819(+) |
| Potential amino acid sequence |
MISTFMCLPPMMNSQNRVPCWSRLSVQATQCFLPISEQVFFY*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2016;Chu et al., 2017 |