Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0137300_circ_g.3 |
| ID in PlantcircBase | osa_circ_008400 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 1730634-1732451 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0137300 |
| Parent gene annotation |
Armadillo-type fold domain containing protein. (Os11t0137300-01) ;Similar to HEAT repeat family protein, expressed. (Os11t0137300 -02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0137300-01:5 Os11t0137300-02:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.122025486 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1732400-1730667(+) 1732379-1732430(-) |
| Potential amino acid sequence |
MCWGDFQLCSYIFWTCSTLYAVARAVAAS*(+) MGVFCRSIAAANAFPYTLQCIFGCIYGNGTTSRLKQLGMEFTVWVFKHAANDQLKLIGPVILSG ILRSLDGSSTTEADSSSRDIKIFAYQAIGLLATRMPNLFSNKTDMAIRLFTALRLEEQSLRLTI QEAATALATAYKVLQVQKI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |