Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0369000_circ_g.7 |
| ID in PlantcircBase | osa_circ_001742 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 15135531-15135734 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0369000 |
| Parent gene annotation |
Similar to Cullin-1. (Os01t0369000-01);Similar to Cullin-1. (Os0 1t0369000-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0369000_circ_g.4 Os01g0369000_circ_g.5 Os01g0369000_circ_g.6 Os01g0369000_circ_g.8 |
| Support reads | 76 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0369000-02:1 Os01t0369000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.513854779 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15135649-15135533(-) |
| Potential amino acid sequence |
MDYYENDFEDFLLKDTADYYSIKAQTWILEDSCPDYMLKIDQEREGEQIDRALLKNVLDIFVEI GLTSMDYYENDFEDFLLKDTADYYSIKAQTWILEDSCPDYMLKIDQEREGEQIDRALLKNVLDI FVEIGLTSMDYYENDFEDFLLKDTADYYSIKAQTWILEDSCPDYMLKIDQEREGEQIDRALLKN VLDIFVEIGLTSMDYYENDFEDFLLKDTADYYSIKAQTWILEDSCPDYMLK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |