Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d027769_circ_g.1 |
| ID in PlantcircBase | zma_circ_006417 |
| Alias | zma_circ_0000267 |
| Organism | Zea mays |
| Position | chr1: 13178975-13179858 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d027769 |
| Parent gene annotation |
Glutathione reductase chloroplastic |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d027769_T004:3 Zm00001d027769_T003:3 Zm00001d027769_T002:3 Zm00001d027769_T001:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.20709655 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13179393-13179040(+) 13179071-13179749(-) |
| Potential amino acid sequence |
MPDIPGIEHVIDSDAALDLPSKPEKIAIVGGGYIALEFAGIFNGLKSEVHVFIRQKKVLRGFDE EVRDFVAEQMSLRGITFHTEQSPQAITKSNDGLLSLKTNKENFGGFSHVMFATGRRPNSKMRAS WMCSKEIASVRIQVLSRV*(+) MSIQIHETLQTRESTWMRTLAISLEHIHEARIFEFGLRPVANITCENPPKFSLLVFKDNRPSFD LVIA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |