Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0308000_circ_g.4 |
| ID in PlantcircBase | osa_circ_019472 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 10963558-10963862 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os03g0308000 |
| Parent gene annotation |
Ubiquitin-conjugating enzyme/RWD-like domain containing protein. (Os03t0308000-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0308000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.442987158 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10963679-10963604(+) 10963856-10963814(+) 10963650-10963830(-) 10963631-10963687(-) |
| Potential amino acid sequence |
MLLTPSGRFEIQKKICLSISNYHPEHWQPSWSGGHLRVAICDPGATRQ*(+) MEWRTSSSGNLRSWGHETVSLREESTMEGSSCHRTIRLSHHHSCCSRQVEDLRFKRRFV*(+) MAAGSFHGRFLPQTHCLVAPGSQIATRRCPPLHDGCQCSGW*(-) MVDSSLKLTVSWPQDRKLPLEDVLHSMMVASAQGGNWICSNKSSFESQIFHLA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |