Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa2G033940_circ_g.1 |
| ID in PlantcircBase | csa_circ_000839 |
| Alias | Chr2:3258870_3259382 |
| Organism | Cucumis sativus |
| Position | chrChr2: 3258870-3259382 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Csa2G033940 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf,root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Csa2G033940.2:3 Csa2G033940.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.133852079 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3259176-3259378(-) |
| Potential amino acid sequence |
MPSRSPKIHGARIRRWRKLHSRRQRRKEKRRKPRMIPLTQIL* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to salt stress in root |
| Other Information | |
|---|---|
| References | Zhu et al., 2019 |