Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0551300_circ_g.2 |
| ID in PlantcircBase | osa_circ_040132 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 21829394-21830318 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0551300 |
| Parent gene annotation |
Similar to predicted protein. (Os09t0551300-01);Bacterial Fmu (S un)/eukaryotic nucleolar NOL1/Nop2p domain containing protein. ( Os09t0551300-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0551300-01:5 Os09t0551300-02:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018746 |
| PMCS | 0.198973081 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21829481-21829415(+) |
| Potential amino acid sequence |
MSYYGYNDFLVEAFIEMFPAVELVELLESFEKRPPECLRTNTLKTRRRDLAAALIPRGFNLDPI GKWSKVGLVVYDSTISAGATVEYMAGHYMKQGASSFLPVMALAPQEKERIVDMACPGTLKL*(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |