Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0551300_circ_g.2 |
ID in PlantcircBase | osa_circ_040132 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 21829394-21830318 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0551300 |
Parent gene annotation |
Similar to predicted protein. (Os09t0551300-01);Bacterial Fmu (S un)/eukaryotic nucleolar NOL1/Nop2p domain containing protein. ( Os09t0551300-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0551300-01:5 Os09t0551300-02:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018746 |
PMCS | 0.198973081 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21829481-21829415(+) |
Potential amino acid sequence |
MSYYGYNDFLVEAFIEMFPAVELVELLESFEKRPPECLRTNTLKTRRRDLAAALIPRGFNLDPI GKWSKVGLVVYDSTISAGATVEYMAGHYMKQGASSFLPVMALAPQEKERIVDMACPGTLKL*(+ ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |