Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0683100_circ_g.1 |
| ID in PlantcircBase | osa_circ_003310 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 28140910-28141649 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0683100 |
| Parent gene annotation |
Similar to Katanin p60 ATPase-containing subunit (EC 3.6.4.3) (K atanin p60 subunit) (p60 katanin) (Atp60) (CAD ATPase) (Katanin 1) (BOTERO1 protein) (ECTOPIC ROOT HAIR 3 protein) (FAT ROOT pro tein) (FRAGILE FIBER 2 protein) (AtAAA1). (Os01t0683100-01);Simi lar to LUE1 protein. (Os01t0683100-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0683100-02:2 Os01t0683100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.306404245 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28140941-28140937(+) 28141069-28141615(-) |
| Potential amino acid sequence |
MFGPPGTGKTLLAKAVATECGTTFFNVSSATLASKWRGESERMVRCLFDLARFYAPSTIFIDEI DSLCTSRGASGEHESSRRVKSELLVQIDGVNNSSTTEDGQPKIVMVLAATNFPWDIDEALRVFA DLGKGF*(+) MRSLSPRHLEARVAEETLKNVVPHSVATAFAKRVFPVPGGPNIRTPFQGRRIPSVLHQYPMESW *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |