Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0414800_circ_g.1 |
ID in PlantcircBase | osa_circ_033506 |
Alias | Os_ciR10872 |
Organism | Oryza sativa |
Position | chr7: 13075824-13076069 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os07g0414800 |
Parent gene annotation |
F-actin capping protein, alpha subunit family protein. (Os07t041 4800-01) |
Parent gene strand | - |
Alternative splicing | Os07g0414800_circ_igg.1 Os07g0414800_circ_igg.2 Os07g0414800_circ_igg.2 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0414800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.31103794 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13076032-13076020(+) 13075875-13076006(-) |
Potential amino acid sequence |
MNSRVQIERQLPLLQYGGILAIDVSIQLHISLFKIMSTYLYFPFNFDKL*(+) MCSWILTSIARIPPYCSNGNWRSIWTLEFIDGLQLVEIKGKIQVGAHYFEEGNVQLDTNIDCKD STILQQRQLALNLDSGIHRWITACRN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |