Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.002G118000_circ_g.1 |
| ID in PlantcircBase | gra_circ_000148 |
| Alias | Chr02:16753013|16754020 |
| Organism | Gossypium raimondii |
| Position | chrChr02: 16753013-16754020 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.002G118000 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.002G118000.3:3 Gorai.002G118000.5:3 Gorai.002G118000.1:3 Gorai.002G118000.4:3 Gorai.002G118000.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.769935078 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16753412-16753045(+) 16753059-16754000(-) |
| Potential amino acid sequence |
METWRLMEEKEIDLNNTCYLLMVRALCRGGYLEEACKFMKFLRENHGTYPLLPVYNCFLGACAK MKSIIHANQCLDLMELQRVGKNEITYSVLLKVMCFWDMEESH*(+) MDFVNGSPPYPKNTLPLEALNM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |